PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 475338
Common NameARALYDRAFT_475338
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 666aa    MW: 73819.7 Da    PI: 6.1248
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
475338genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.87.6e-22124225199
             EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
             f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d+++++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + +++el+v+v
  475338 124 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHNNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL--RGENEELRVGV 222
             99****************************964333..4459************************************************..3488889**** PP

             E-S CS
      B3  97 frk 99 
             +r+
  475338 223 RRH 225
             996 PP

2Auxin_resp112.34.7e-37250332183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha++t+++F+v+Y+Pr+s+seF+v+v+++++a ++k+svGmRfkm+fe+e+++e+r+sGt+vgv++ +++ W++S+WrsLk
      475338 250 AAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLK 332
                 79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-44113253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-40121239IPR015300DNA-binding pseudobarrel domain
CDDcd100171.88E-19122224No hitNo description
SMARTSM010194.9E-21124226IPR003340B3 DNA binding domain
PROSITE profilePS5086310.588124226IPR003340B3 DNA binding domain
PfamPF023621.1E-19124225IPR003340B3 DNA binding domain
PfamPF065073.5E-34250332IPR010525Auxin response factor
PfamPF023099.9E-12535632IPR033389AUX/IAA domain
PROSITE profilePS5174529.676542635IPR000270PB1 domain
SuperFamilySSF542773.27E-11544619No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MAATTHSSVK PGGVLSDALC TELWHACAGP LVTLPREGER VYYFPEGHME QLEASMHQGL  60
EQQMPSFNLP SKILCKVINI QRRAEPETDE VYAQITLLPE LDQNEPTSPD APVQEPEKCT  120
VHSFCKTLTA SDTSTHGGFS VLRRHADDCL PPLDMSQQPP WQELVATDLH NNEWHFRHIF  180
RGQPRRHLLT TGWSVFVSSK KLVAGDAFIF LRGENEELRV GVRRHMRQQT NIPSSVISSH  240
SMHIGVLATA AHAITTGTIF SVFYKPRTSR SEFIVSVNRY LEAKTQKLSV GMRFKMRFEG  300
EEAPEKRFSG TIVGVQENKS SVWHDSEWRS LKVQWDEPSS VFRPERVSPW ELEPLVANST  360
PSSQPQPPQR NKRPRPPGLP SPTTGPSAPV TPDGVWKSPA DTPSSVPLFS PPAKAATFGH  420
GGNKSFGVSI GSAFWPSHAD SAAESFASAF NNESTEKKQT NGNVCRLFGF ELVENVNVDE  480
CFSAASVSGA VAVDQPVPSN EFDSGQQSEP LNINQSDIPS GSDDPENSSL RSPQESQSRQ  540
IRSCTKVHMQ GSAVGRAVDL TRSECYEDLF KKLEEMFEIK GELLKSTKKW QVVYTDDEDD  600
MMMVGDDPWN EFCGMVRKIF IYTPEEVKKL SPKNKLAVNA RMQPKTDAEE NGNTEGRSSS  660
MAGSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.013591359Auxin response factor 1
4ldw_A0.013591359Auxin response factor 1
4ldw_B0.013591359Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371375KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3172140.0AK317214.1 Arabidopsis thaliana AT1G59750 mRNA, complete cds, clone: RAFL22-03-B07.
GenBankATU832450.0U83245.1 Arabidopsis thaliana auxin response factor 1 (ARF1) mRNA, complete cds.
GenBankBT0027480.0BT002748.1 Arabidopsis thaliana clone C105458 auxin response factor 1 (At1g59750) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888184.10.0hypothetical protein ARALYDRAFT_475338
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLD7KXS00.0D7KXS0_ARALL; Auxin response factor
STRINGfgenesh2_kg.2__468__AT1G59750.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1